Total number of results for Anas platyrhynchos are 4
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00020 |
MFQAHLLRGTLTLSFFLHQADFDEAAEEVKKLKTRPTDEELKELYGFYKQATVGDINIECPGMLDLKGKAKWEAWNLKKGISKEDAMNAYISKAKTMVEKYGI
|
103 | Anas platyrhynchos | ACBP | Acyl-CoA-binding protein | ||
| NP02290 |
HSQGTFTSDYSKYLDTRRAQDFVQWLMST
|
29 | Anas platyrhynchos | Glucagon | Glucagon | 4636745#Sundby F., Frandsen E.K., Thomsen J., Kristiansen K., Brunfeldt K.#Crystallization and amino acid sequence of duck glucagon.# FEBS Lett. 26:289-293(1972). | |
| NP02609 |
AANQHLCGSHLVEALYLVCGERGFFYSPKT
|
30 | Anas platyrhynchos | Insulin | Insulin B chain | 4763354#Markussen J., Sundby F.#Duck insulin: isolation, crystallization and amino acid sequence.# Int. J. Pept. Protein Res. 5:37-48(1973). | |
| NP02610 |
GIVEQCCENPCSLYQLENYCN
|
21 | Anas platyrhynchos | Insulin | Insulin A chain | 4763354#Markussen J., Sundby F.#Duck insulin: isolation, crystallization and amino acid sequence.# Int. J. Pept. Protein Res. 5:37-48(1973). |